Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [11]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030522 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030522, RRID:AB_10602096
- Product name
- Anti-PCNA
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDY
EMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICR
DLSHIGDAVVISCA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Human glioblastoma multiforme: p53 reactivation by a novel MDM2 inhibitor.
Costa B, Bendinelli S, Gabelloni P, Da Pozzo E, Daniele S, Scatena F, Vanacore R, Campiglia P, Bertamino A, Gomez-Monterrey I, Sorriento D, Del Giudice C, Iaccarino G, Novellino E, Martini C
PloS one 2013;8(8):e72281
PloS one 2013;8(8):e72281
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-PCNA antibody HPA030522 (A) shows similar pattern to independent antibody HPA030521 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human small intestine and skeletal muscle tissues using HPA030522 antibody. Corresponding PCNA RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow, kidney, lymph node and testis using Anti-PCNA antibody HPA030522 (A) shows similar protein distribution across tissues to independent antibody HPA030521 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate to strong nuclear positivity in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in epidermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows very weak nuclear positivity in myocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-PCNA antibody HPA030522.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow using Anti-PCNA antibody HPA030522.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-PCNA antibody HPA030522.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-PCNA antibody HPA030522.
- Sample type
- HUMAN
