Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005111-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005111-M02, RRID:AB_437048
- Product name
- PCNA monoclonal antibody (M02), clone 1G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PCNA.
- Antigen sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGV
NLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGV
NLTSMSKILKCAGNEDIITLRAEDNADTLALVFEA
PNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMP
SGEFARICRDLSHIGDAVVISCAKDGVKFSASGEL
GNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALR
YLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMG
HLKYYLAPKIEDEEGS- Isotype
- IgG
- Antibody clone number
- 1G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The RAD51-stimulatory compound RS-1 can exploit the RAD51 overexpression that exists in cancer cells and tumors.
Mason JM, Logan HL, Budke B, Wu M, Pawlowski M, Weichselbaum RR, Kozikowski AP, Bishop DK, Connell PP
Cancer research 2014 Jul 1;74(13):3546-55
Cancer research 2014 Jul 1;74(13):3546-55
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCNA monoclonal antibody (M02), clone 1G7 Western Blot analysis of PCNA expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PCNA expression in transfected 293T cell line by PCNA monoclonal antibody (M02), clone 1G7.Lane 1: PCNA transfected lysate(28.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PCNA is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PCNA on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PCNA transfected lysate using anti-PCNA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PCNA MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol