Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503510 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Galactosidase, alpha (GLA) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GLA antibody: synthetic peptide directed towards the N terminal of human GLA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAG
FPGSF GYYDIDAQTF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Urinary globotriaosylceramide excretion correlates with the genotype in children and adults with Fabry disease.
Auray-Blais C, Cyr D, Ntwari A, West ML, Cox-Brinkman J, Bichet DG, Germain DP, Laframboise R, Melançon SB, Stockley T, Clarke JT, Drouin R
Molecular genetics and metabolism 2008 Mar;93(3):331-40
Molecular genetics and metabolism 2008 Mar;93(3):331-40
No comments: Submit comment
No validations: Submit validation data