HPA000237

GLA antibody from Sigma-Aldrich
GALA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000237
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000237, RRID:AB_1078968
Product name
Anti-GLA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000237
Antibody type
Polyclonal
Antigen
alpha-Galactosidase A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDN
FEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVAS
LGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSH
INPTGT
Storage
-20C
Provider Type Product Number
- No reagents -