Antibody data

Product number
H00003170-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003170-M03, RRID:AB_606259
Product name
FOXA2 monoclonal antibody (M03), clone 8H5
Provider product page
Abnova Corporation - H00003170-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FOXA2.
Antigen sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQP
HKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTG
LDASPLAADTSYYQGVYSRPIMNSS
Isotype
IgM
Antibody clone number
8H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -