Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183809 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Forkhead Box A2 (FOXA2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the C terminal of human FOXA2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAAD
TSYYQ GVYSRPIMNS- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A hepatocyte nuclear factor-3 site in the fibrinogen beta promoter is important for interleukin 6-induced expression, and its activity is influenced by the adjacent -148C/T polymorphism.
Verschuur M, de Jong M, Felida L, de Maat MP, Vos HL
The Journal of biological chemistry 2005 Apr 29;280(17):16763-71
The Journal of biological chemistry 2005 Apr 29;280(17):16763-71
No comments: Submit comment
No validations: Submit validation data