Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007391-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007391-M02, RRID:AB_463849
- Product name
- USF1 monoclonal antibody (M02), clone 2A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant USF1.
- Antigen sequence
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIAS
IQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ
LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAV
DTEGT- Isotype
- IgG
- Antibody clone number
- 2A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Association of thymidylate synthase enhancer region polymorphisms with thymidylate synthase activity in vivo.
Use of a single-chain antibody library for ovarian cancer biomarker discovery.
A role of DNA-PK for the metabolic gene regulation in response to insulin.
de Bock CE, Garg MB, Scott N, Sakoff JA, Scorgie FE, Ackland SP, Lincz LF
The pharmacogenomics journal 2011 Aug;11(4):307-14
The pharmacogenomics journal 2011 Aug;11(4):307-14
Use of a single-chain antibody library for ovarian cancer biomarker discovery.
Ramirez AB, Loch CM, Zhang Y, Liu Y, Wang X, Wayner EA, Sargent JE, Sibani S, Hainsworth E, Mendoza EA, Eugene R, Labaer J, Urban ND, McIntosh MW, Lampe PD
Molecular & cellular proteomics : MCP 2010 Jul;9(7):1449-60
Molecular & cellular proteomics : MCP 2010 Jul;9(7):1449-60
A role of DNA-PK for the metabolic gene regulation in response to insulin.
Wong RH, Chang I, Hudak CS, Hyun S, Kwan HY, Sul HS
Cell 2009 Mar 20;136(6):1056-72
Cell 2009 Mar 20;136(6):1056-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- USF1 monoclonal antibody (M02), clone 2A7 Western Blot analysis of USF1 expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged USF1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol