Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007391-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007391-A01, RRID:AB_462282
- Product name
- USF1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant USF1.
- Antigen sequence
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIAS
IQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQ
LDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAV
DTEGT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Histone crosstalk directed by H2B ubiquitination is required for chromatin boundary integrity.
Use of a single-chain antibody library for ovarian cancer biomarker discovery.
Ma MK, Heath C, Hair A, West AG
PLoS genetics 2011 Jul;7(7):e1002175
PLoS genetics 2011 Jul;7(7):e1002175
Use of a single-chain antibody library for ovarian cancer biomarker discovery.
Ramirez AB, Loch CM, Zhang Y, Liu Y, Wang X, Wayner EA, Sargent JE, Sibani S, Hainsworth E, Mendoza EA, Eugene R, Labaer J, Urban ND, McIntosh MW, Lampe PD
Molecular & cellular proteomics : MCP 2010 Jul;9(7):1449-60
Molecular & cellular proteomics : MCP 2010 Jul;9(7):1449-60
No comments: Submit comment
No validations: Submit validation data