Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006663-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006663-M01, RRID:AB_1137471
- Product name
- SOX10 monoclonal antibody (M01), clone 1E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SOX10.
- Antigen sequence
KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYT
DQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDH
QPSGPYYGHSGQASGLYSAFSYMGPSQR- Isotype
- IgG
- Antibody clone number
- 1E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Histopathological study of the treatment of melasma lesions using a low-fluence Q-switched 1064-nm neodymium:yttrium-aluminium-garnet laser.
Kim JE, Chang SE, Yeo UC, Haw S, Kim IH
Clinical and experimental dermatology 2013 Mar;38(2):167-71
Clinical and experimental dermatology 2013 Mar;38(2):167-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SOX10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol