Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000208-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000208-M03, RRID:AB_875457
- Product name
- AKT2 monoclonal antibody (M03), clone 1D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AKT2.
- Antigen sequence
MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTE
EMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILV
REKATGRYYAMKILRKEVII- Isotype
- IgG
- Antibody clone number
- 1D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Multiple defects in negative regulation of the PKB/Akt pathway sensitise human cancer cells to the antiproliferative effect of non-steroidal anti-inflammatory drugs.
Lincová E, Hampl A, Pernicová Z, Starsíchová A, Krcmár P, Machala M, Kozubík A, Soucek K
Biochemical pharmacology 2009 Sep 15;78(6):561-72
Biochemical pharmacology 2009 Sep 15;78(6):561-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AKT2 monoclonal antibody (M03), clone 1D9. Western Blot analysis of AKT2 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AKT2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol