Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504583 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-V-Akt Murine Thymoma Viral Oncogene Homolog 2 (AKT2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AKT2 antibody: synthetic peptide directed towards the N terminal of human AKT2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
NTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQM
VANSL KQRAPGEDPM- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel recurrent chromosomal inversion implicates the homeobox gene Dlx5 in T-cell lymphomas from Lck-Akt2 transgenic mice.
Tan Y, Timakhov RA, Rao M, Altomare DA, Xu J, Liu Z, Gao Q, Jhanwar SC, Di Cristofano A, Wiest DL, Knepper JE, Testa JR
Cancer research 2008 Mar 1;68(5):1296-302
Cancer research 2008 Mar 1;68(5):1296-302
No comments: Submit comment
No validations: Submit validation data