Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000581-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000581-M01, RRID:AB_425323
- Product name
- BAX monoclonal antibody (M01), clone 1F5-1B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant BAX.
- Antigen sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRA
GRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNF
NWGRVVALFYFASKLVLKALCTKVPELIRTIMGWT
LDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTATI
FVAGVLTASLTIWKKMG- Isotype
- IgG
- Antibody clone number
- 1F5-1B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references p53 is positively regulated by miR-542-3p.
Wang Y, Huang JW, Castella M, Huntsman DG, Taniguchi T
Cancer research 2014 Jun 15;74(12):3218-27
Cancer research 2014 Jun 15;74(12):3218-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to BAX on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to BAX on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between BCL2L1 and BAX. HeLa cells were stained with anti-BCL2L1 rabbit purified polyclonal 1:1200 and anti-BAX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)