Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184149 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-BCL2-Associated X Protein (BAX) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BAX antibody: synthetic peptide directed towards the N terminal of human BAX
- Description
- Protein A purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRA
GRMGG EAPELALDPV- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Bid cleavage, cytochrome c release and caspase activation in canine coronavirus-induced apoptosis.
Activation of caspase 3, 9, 12, and Bax in masseter muscle of mdx mice during necrosis.
Regulation of Bax activation and apoptotic response to microtubule-damaging agents by p53 transcription-dependent and -independent pathways.
De Martino L, Marfé G, Longo M, Fiorito F, Montagnaro S, Iovane V, Decaro N, Pagnini U
Veterinary microbiology 2010 Feb 24;141(1-2):36-45
Veterinary microbiology 2010 Feb 24;141(1-2):36-45
Activation of caspase 3, 9, 12, and Bax in masseter muscle of mdx mice during necrosis.
Honda A, Abe S, Hiroki E, Honda H, Iwanuma O, Yanagisawa N, Ide Y
Journal of muscle research and cell motility 2007;28(4-5):243-7
Journal of muscle research and cell motility 2007;28(4-5):243-7
Regulation of Bax activation and apoptotic response to microtubule-damaging agents by p53 transcription-dependent and -independent pathways.
Yamaguchi H, Chen J, Bhalla K, Wang HG
The Journal of biological chemistry 2004 Sep 17;279(38):39431-7
The Journal of biological chemistry 2004 Sep 17;279(38):39431-7
No comments: Submit comment
No validations: Submit validation data