HPA027878

BAX antibody from Sigma-Aldrich
BCL2L4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027878
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027878, RRID:AB_10601687
Product name
Anti-BAX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027878
Antibody type
Polyclonal
Antigen
BCL2-associated X protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELA
LDPVPQDASTKKLSECLKRIGDELDSNMELQRMIA
AVDTDSPREVFFRVAADMFSDGNFNW
Storage
-20C
Provider Type Product Number
- No reagents -