HPA023981

NCL antibody from Sigma-Aldrich
C23
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023981
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023981, RRID:AB_1854688
Product name
Anti-NCL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023981
Antibody type
Polyclonal
Antigen
Nucleolin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSK
GYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQ
GPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFD
GSVRARIVTDRETGSSKGFGFVDFNSEEDA
Storage
-20C
Provider Type Product Number
- No reagents -