WH0051566M1

ARMCX3 antibody from Sigma-Aldrich
ALEX3, GASP6
ELISA
Recommended by provider

Antibody data

Product number
WH0051566M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0051566M1, RRID:AB_1839839
Product name
Monoclonal Anti-ARMCX3 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0051566M1
Antibody type
Monoclonal
Antigen
ARMCX3 (NP_057691, a.a. 278-380) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENI
NDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKV
LGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE* (
without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -