Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051566-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051566-M01, RRID:AB_509390
- Product name
- ARMCX3 monoclonal antibody (M01), clone 2G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARMCX3.
- Antigen sequence
RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENI
NDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKV
LGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE- Isotype
- IgG
- Antibody clone number
- 2G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ARMCX3 monoclonal antibody (M01), clone 2G3. Western Blot analysis of ARMCX3 expression in U-2 OS.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ARMCX3 expression in transfected 293T cell line by ARMCX3 monoclonal antibody (M01), clone 2G3.Lane 1: ARMCX3 transfected lysate (Predicted MW: 42.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ARMCX3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol