HPA000325

ARMCX3 antibody from Atlas Antibodies
ALEX3, GASP6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000325
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000325, RRID:AB_611317
Product name
Anti-ARMCX3
Provider product page
Atlas Antibodies - HPA000325
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKS
IVWYPPWARIGTEAGTRARARARARATRARRAVQK
RASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAA
LIALGNNAAY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -