HPA000325

ARMCX3 antibody from Atlas Antibodies
ALEX3, GASP6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000325
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000325, RRID:AB_1078206
Product name
Anti-ARMCX3
Provider product page
Atlas Antibodies - HPA000325
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKS
IVWYPPWARIGTEAGTRARARARARATRARRAVQK
RASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAA
LIALGNNAAY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -