HPA000325

ARMCX3 antibody from Sigma-Aldrich
ALEX3, GASP6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000325
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000325, RRID:AB_1078206
Product name
Anti-ARMCX3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000325
Antibody type
Polyclonal
Antigen
Armadillo repeat-containing X-linked protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKS
IVWYPPWARIGTEAGTRARARARARATRARRAVQK
RASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAA
LIALGNNAAY
Storage
-20C
Provider Type Product Number
- No reagents -