H00005594-M01
antibody from Abnova Corporation
Targeting: MAPK1
ERK, ERK2, MAPK2, p41mapk, PRKM1, PRKM2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005594-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005594-M01, RRID:AB_425615
- Product name
- MAPK1 monoclonal antibody (M01), clone 1D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MAPK1.
- Antigen sequence
RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLT
FNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFK
FDMELDDLPKEKLKELIFEETARFQPGYRS- Isotype
- IgG
- Antibody clone number
- 1D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MAPK1 monoclonal antibody (M01), clone 1D1 Western Blot analysis of MAPK1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MAPK1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MAPK1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TP53 and MAPK1. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MAPK1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MAPK3 and MAPK1. Huh7 cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-MAPK1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)