Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 16-283 - Provider product page

- Provider
- EMD Millipore
- Proper citation
- Millipore Cat#16-283, RRID:AB_11214004
- Product name
- Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT, Alexa Fluor® 488 conjugate
- Antibody type
- Polyclonal
- Antigen
- 38 residue synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of the rat 44kDa MAP Kinase 2/Erk2 coupled to KLH. The immunizing sequence is totally conserved in Chinese hamster, is 34/35 identical in mouse, and 32/35 identical in human.
- Reactivity
- Human, Mouse, Rat, Chicken/Avian
- Host
- Rabbit
- Conjugate
- Green dye
- Isotype
- IgG
- Vial size
- 50 µg
- Storage
- 1 year at 4°C from date of shipment
No comments: Submit comment
No validations: Submit validation data