Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 06-182 - Provider product page

- Provider
- EMD Millipore
- Proper citation
- Millipore Cat#06-182, RRID:AB_310068
- Product name
- Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT
- Antibody type
- Polyclonal
- Antigen
- 38 residue synthetic peptide (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of the rat 44kDa MAP Kinase 2/Erk2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian, Sheep, Xenopus
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 100 µg
- Storage
- Maintain for 1 year at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
No comments: Submit comment
No validations: Submit validation data