HPA026321

HDAC6 antibody from Atlas Antibodies
FLJ16239, HD6, JM21, KIAA0901, PPP1R90

Antibody data

Product number
HPA026321
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026321, RRID:AB_1850546
Product name
Anti-HDAC6
Provider product page
Atlas Antibodies - HPA026321
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QVHRRYWRSLRVMKVEDREGPSSSKLVTKKAPQPA
KPRLAERMTTREKKVLEAGMGKVTSASFGEESTPG
QTNSETAVVALTQDQPSEAATGGATLAQTISEAAI
GGAMLGQTTSEEAVGGATPDQTTSEETVGGA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.