H00010013-M01
antibody from Abnova Corporation
Targeting: HDAC6
FLJ16239, HD6, JM21, KIAA0901, PPP1R90
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010013-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010013-M01, RRID:AB_464293
- Product name
- HDAC6 monoclonal antibody (M01), clone 1E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HDAC6.
- Antigen sequence
DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHML
QHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLD
VKNIAHQNKFGEDMPHPH- Isotype
- IgG
- Antibody clone number
- 1E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
Bantscheff M, Hopf C, Savitski MM, Dittmann A, Grandi P, Michon AM, Schlegl J, Abraham Y, Becher I, Bergamini G, Boesche M, Delling M, Dümpelfeld B, Eberhard D, Huthmacher C, Mathieson T, Poeckel D, Reader V, Strunk K, Sweetman G, Kruse U, Neubauer G, Ramsden NG, Drewes G
Nature biotechnology 2011 Mar;29(3):255-65
Nature biotechnology 2011 Mar;29(3):255-65
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HDAC6 monoclonal antibody (M01), clone 1E2 Western Blot analysis of HDAC6 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HDAC6 expression in transfected 293T cell line by HDAC6 monoclonal antibody (M01), clone 1E2.Lane 1: HDAC6 transfected lysate (Predicted MW: 131.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HDAC6 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol