H00010013-M13

HDAC6 antibody from Abnova Corporation
FLJ16239, HD6, JM21, KIAA0901, PPP1R90

Antibody data

Product number
H00010013-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010013-M13, RRID:AB_1575859
Product name
HDAC6 monoclonal antibody (M13), clone 3A6
Provider product page
Abnova Corporation - H00010013-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant HDAC6.
Antigen sequence
METTQYMNEGELRVLADTYDSVYLHPNSYSCACLA
SGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLM
DGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHG
QGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNW
STTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVL
LPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAG
FAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSA
SLHTLLGDPCPMLESPGAPCRSAQASVSCALEALE
PFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPP
VLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPE
VPQRILRIMCRLEELGLAGRCLTLTPRPATEAELL
TCHSAEYVGHLRATEKMKTRELHRESSNFDSIYIC
PSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRP
PGHHAEQDAACGFCFFNSVAVAARHAQTISGHALR
ILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHG
TFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGD
ADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGD
PLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGY
NLTSISESMAACTRSLLGDPPPLLTLPRPPLSGAL
ASITETIQVHRRYWRSLRVMKVEDREGPSSSKLVT
KKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASF
GEESTPGQTNSETAVVALTQDQPSEAATGGATLAQ
TISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETV
GGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQ
TTSEAAMEGATLDQTTSEEAPGGTELIQTPLASST
DHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSES
QGASESQAPGEENLLGEAAGGQDMADSMLMQGSRG
LTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQP
CGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGN
SGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIA
HQNKFGEDMPHPH
Isotype
IgG
Antibody clone number
3A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -