HPA003714

HDAC6 antibody from Sigma-Aldrich
FLJ16239, HD6, JM21, KIAA0901, PPP1R90
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003714
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003714, RRID:AB_1850544
Product name
Anti-HDAC6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003714
Antibody type
Polyclonal
Antigen
Histone deacetylase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAQASVSCALEALEPFWEVLVRSTETVERDNMEED
NVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN
MMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRC
LTLTPRPATEAELLTCHSAEYVGHL
Storage
-20C
Provider Type Product Number
- No reagents -