H00080231-B01P

TASL antibody from Abnova Corporation
CXorf21, FLJ11577

Antibody data

Product number
H00080231-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080231-B01P, RRID:AB_10550274
Product name
CXorf21 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00080231-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CXorf21 protein.
Antigen sequence
MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEET
NSVATLSYSSVDETQVRSLYVSCKSSGKFISSVHS
RESQHSRSQRVTVLQTNPNPVFESPNLAAVEICRD
ASRETYLVPSSCKSICKNYNDLQIAGGQVMAINSV
TTDFPSESSFEYGPLLKSSEIPLPMEDSISTQPSD
FPQKPIQRYSSYWRITSIKEKSSLQMQNPISNAVL
NEYLEQKVVELYKQYIMDTVFHDSSPTQILASELI
MTSVDQISLQVSREKNLETSKARDIVFSRLLQLMS
TEITEISTPSLHISQYSNVNP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.