H00003918-A01
antibody from Abnova Corporation
Targeting: LAMC2
BM600-100kDa, EBR2, EBR2A, kalinin-105kDa, LAMB2T, LAMNB2, nicein-100kDa
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003918-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003918-A01, RRID:AB_1576750
- Product name
- LAMC2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LAMC2.
- Antigen sequence
VDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEE
GLVLLEQKLSRAKTQINSQLRPMMSELEERARQQR
GHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQ
ALEQQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LAMC2 polyclonal antibody (A01), Lot # 051003JC01. Western Blot analysis of LAMC2 expression in NIH/3T3.