H00003918-A01

LAMC2 antibody from Abnova Corporation
BM600-100kDa, EBR2, EBR2A, kalinin-105kDa, LAMB2T, LAMNB2, nicein-100kDa

Antibody data

Product number
H00003918-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003918-A01, RRID:AB_1576750
Product name
LAMC2 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00003918-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant LAMC2.
Antigen sequence
VDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEE
GLVLLEQKLSRAKTQINSQLRPMMSELEERARQQR
GHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQ
ALEQQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -