R31813

antibody from NSJ Bioreagents

Targeting: PDPK1 PDK1

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

R31813

Provider

NSJ Bioreagents

Product name

PDPK1 Antibody / 3-phosphoinositide-dependent protein kinase 1

Antibody type

Polyclonal

Antigen

Amino acids YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ of human PDPK1 were used as the immunogen for the PDPK1 antibody.

Description

Antigen affinity

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Vial size

100 µg

Concentration

Lyophilized; resuspend with 200 ul for 0.5 mg/ml

Storage

After reconstitution, the PDPK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Western blot

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

Western blot testing of 1) rat liver, 2) rat lung, 3) mouse liver, 4) mouse lung, 5) human COLO320 and 6) human MCF7 lysate with PDPK1 antibody. Expected molecular weight ~63 kDa, observed here at ~70 kDa.

Immunohistochemistry

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE human lung cancer tissue with PDPK1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE mouse intestine with PDPK1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE rat testis with PDPK1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of frozen human placental tissue with PDPK1 antibody.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of frozen mouse small intestine tissue with PDPK1 antibody.