Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005170-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005170-M05, RRID:AB_10634136
- Product name
- PDPK1 monoclonal antibody (M05), clone 2E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PDPK1.
- Antigen sequence
ILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVN
KVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLM
DPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ- Isotype
- IgG
- Antibody clone number
- 2E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PDPK1 expression in transfected 293T cell line by PDPK1 monoclonal antibody (M05), clone 2E2.Lane 1: PDPK1 transfected lysate (Predicted MW: 48.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PDPK1 monoclonal antibody (M05), clone 2E2. Western Blot analysis of PDPK1 expression in IMR-32.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PDPK1 monoclonal antibody (M05), clone 2E2. Western Blot analysis of PDPK1 expression in rat brain.