H00005335-M01
antibody from Abnova Corporation
Targeting: PLCG1
NCKAP3, PLC-II, PLC1, PLC148, PLCgamma1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005335-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005335-M01, RRID:AB_463816
- Product name
- PLCG1 monoclonal antibody (M01), clone 2A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PLCG1.
- Antigen sequence
LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSG
TSLRERGSDASGQLFHGRAREGSFESRYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL- Isotype
- IgG
- Antibody clone number
- 2A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49
Molecular & cellular proteomics : MCP 2013 May;12(5):1335-49
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PLCG1 monoclonal antibody (M01), clone 2A2 Western Blot analysis of PLCG1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PLCG1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PLCG1 on HeLa cell. [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between PTK2 and PLCG1. HeLa cells were stained with anti-PTK2 rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)