ABIN503352

WDR89 antibody from antibodies-online
C14orf150, MGC9907
Western blot
Data presented on provider website

Antibody data

Product number
ABIN503352
Provider
antibodies-online
Product name
anti-WD Repeat Domain 89 (WDR89) (Middle Region) antibody
Provider product page
antibodies-online - ABIN503352
Antibody type
Polyclonal
Antigen
The immunogen for anti-WDR89 antibody: synthetic peptide directed towards the middle region of human WDR89
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus
Host
Rabbit
Antigen sequence
TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTF
TKKES MKIASSVHQR
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.