HPA000813

WDR89 antibody from Sigma-Aldrich
C14orf150, MGC9907
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000813
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000813, RRID:AB_1078324
Product name
Anti-WDR89 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000813
Antibody type
Polyclonal
Antigen
WD repeat protein 89 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKED
ALDYLIGGLYHEKTDTLHVIGGTNKGRIHLMNCSM
SGLTHVTSLQGGHAATVRSFCWNVQDDSLLTGGED
AQLLLWKPGAIEKTFTKKESMKIASSVHQRVRVHS
N
Storage
-20C
Provider Type Product Number
- No reagents -