H00004112-M09
antibody from Abnova Corporation
Targeting: MAGEB1
CT3.1, DAM10, MAGE-Xp, MAGEL1, MGC9322
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004112-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004112-M09, RRID:AB_1679125
- Product name
- MAGEB1 monoclonal antibody (M09), clone 3C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAGEB1.
- Antigen sequence
QGEENASFSQATTSTESSVKDPVAWEAGMLMHFIL
RKYKMREPIMKADMLKVVDEKYKDHFTEILNGASR
RLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLS
NDWDF- Isotype
- IgG
- Antibody clone number
- 3C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MAGEB1 expression in transfected 293T cell line by MAGEB1 monoclonal antibody (M09), clone 3C1.Lane 1: MAGEB1 transfected lysate (Predicted MW: 39 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MAGEB1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MAGEB1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol