HPA002820

MAGEB1 antibody from Atlas Antibodies
CT3.1, DAM10, MAGE-Xp, MAGEL1, MGC9322
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002820
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002820, RRID:AB_1079295
Product name
Anti-MAGEB1
Provider product page
Atlas Antibodies - HPA002820
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQ
KPQGAPPTTTAAAAVSCTESDEGAKCQGEENASFS
QATTSTESSVKDPVAWEAGMLMHFILRKYKMREPI
MKADMLKVVDEKYKDHFTEILNGASR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -