HPA001193

MAGEB1 antibody from Sigma-Aldrich
CT3.1, DAM10, MAGE-Xp, MAGEL1, MGC9322
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001193
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001193, RRID:AB_1079296
Product name
Anti-MAGEB4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001193
Antibody type
Polyclonal
Antigen
Melanoma-associated antigen B1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKY
EQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKM
NGATPRDFPSHYEEALRDEEERAQVRSSVRARRRT
TATTFRARSRAPFSRSS
Storage
-20C
Provider Type Product Number
- No reagents -