Antibody data

Product number
H00005316-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005316-M13, RRID:AB_1237818
Product name
PKNOX1 monoclonal antibody (M13), clone 1F12
Provider product page
Abnova Corporation - H00005316-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PKNOX1.
Antigen sequence
MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEP
DAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALL
FEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGK
PFFCEDPETDNLMVKAIQVLRIHLLELEKVNELCK
DFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQ
IQSAITGTISPQGIVVPASALQQGNVAMATVAGGT
VYQPVTVVTPQGQVVTQTLSPGTIRIQNSQLQLQL
NQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQ
HIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARR
RILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSI
ASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQS
LSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALA
PAHISGLVLENSDSLQ
Isotype
IgG
Antibody clone number
1F12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -