HPA021676

RACK1 antibody from MilliporeSigma / Merck KGaA
Gnb2-rs1, GNB2L1, H12.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021676
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021676, RRID:AB_1849868
Product name
Anti-GNB2L1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021676
Antibody type
Polyclonal
Antigen
Guanine nucleotide-binding protein subunit beta-2-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTN
HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLN
EGKHLYTLDG
Storage
-20C
Provider Type Product Number
- No reagents -