Antibody data

Product number
H00009495-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009495-M04, RRID:AB_1137086
Product name
AKAP5 monoclonal antibody (M04), clone 1A9
Provider product page
Abnova Corporation - H00009495-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AKAP5.
Antigen sequence
RMEPIAIIITDTEISEFDVTKSKNVPKQFLISAEN
EQVGVFANDNGFEDRTSEQYETLLIETASSLVKNA
IQLSIEQLVNEMASDDNKINNLLQ
Isotype
IgG
Antibody clone number
1A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -