Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000302-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000302-M02, RRID:AB_425303
- Product name
- ANXA2 monoclonal antibody (M02), clone 1G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ANXA2.
- Antigen sequence
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDA
ERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQD
IAFAYQRRTKKELASALKSALSGHLETVILGLLKT
PAQYDASELKASMKGLGTDEDSLIEIICSRTNQEL
QEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALA
KGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV
PKWISVMTERSVPHLQKVFDRYKSYSPYDMLESIR
KEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKG
KGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSL
YYYIQQDTKGDYQKALLYLCGGDD- Isotype
- IgG
- Antibody clone number
- 1G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The interaction of enolase-1 with caveolae-associated proteins regulates its subcellular localization.
Peripheral blood monocyte-expressed ANXA2 gene is involved in pathogenesis of osteoporosis in humans.
Proteomic analysis of climatic keratopathy droplets.
Zakrzewicz D, Didiasova M, Zakrzewicz A, Hocke AC, Uhle F, Markart P, Preissner KT, Wygrecka M
The Biochemical journal 2014 Jun 1;460(2):295-307
The Biochemical journal 2014 Jun 1;460(2):295-307
Peripheral blood monocyte-expressed ANXA2 gene is involved in pathogenesis of osteoporosis in humans.
Deng FY, Lei SF, Zhang Y, Zhang YL, Zheng YP, Zhang LS, Pan R, Wang L, Tian Q, Shen H, Zhao M, Lundberg YW, Liu YZ, Papasian CJ, Deng HW
Molecular & cellular proteomics : MCP 2011 Nov;10(11):M111.011700
Molecular & cellular proteomics : MCP 2011 Nov;10(11):M111.011700
Proteomic analysis of climatic keratopathy droplets.
Menegay M, Lee D, Tabbara KF, Cafaro TA, Urrets-ZavalĂa JA, Serra HM, Bhattacharya SK
Investigative ophthalmology & visual science 2008 Jul;49(7):2829-37
Investigative ophthalmology & visual science 2008 Jul;49(7):2829-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ANXA2 monoclonal antibody (M02), clone 1G7 Western Blot analysis of ANXA2 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ANXA2 expression in transfected 293T cell line by ANXA2 monoclonal antibody (M02), clone 1G7.Lane 1: ANXA2 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ANXA2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol