Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000302-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000302-M01, RRID:AB_464165
- Product name
- ANXA2 monoclonal antibody (M01), clone 3E8-B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ANXA2.
- Antigen sequence
MFTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDA
ERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQD
IAFAYQRRTKKELASALKSALSGHLETLILGLLKT
PAQYDASELKASMKGLGTDEDSLIEIICSRTNQEL
QEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALA
KGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV
PKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIR
KEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKG
KGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSL
YYYIQQDTKGDYQKALLYLCGGDD- Isotype
- IgG
- Antibody clone number
- 3E8-B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Annexin A2 is a discriminative serological candidate in early hepatocellular carcinoma.
Peripheral blood monocyte-expressed ANXA2 gene is involved in pathogenesis of osteoporosis in humans.
Sun Y, Gao G, Cai J, Wang Y, Qu X, He L, Liu F, Zhang Y, Lin K, Ma S, Yang X, Qian X, Zhao X
Carcinogenesis 2013 Mar;34(3):595-604
Carcinogenesis 2013 Mar;34(3):595-604
Peripheral blood monocyte-expressed ANXA2 gene is involved in pathogenesis of osteoporosis in humans.
Deng FY, Lei SF, Zhang Y, Zhang YL, Zheng YP, Zhang LS, Pan R, Wang L, Tian Q, Shen H, Zhao M, Lundberg YW, Liu YZ, Papasian CJ, Deng HW
Molecular & cellular proteomics : MCP 2011 Nov;10(11):M111.011700
Molecular & cellular proteomics : MCP 2011 Nov;10(11):M111.011700
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ANXA2 monoclonal antibody (M01), clone 3E8-B6 Western Blot analysis of ANXA2 expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ANXA2 expression in transfected 293T cell line by ANXA2 monoclonal antibody (M01), clone 3E8-B6.Lane 1: ANXA2 transfected lysate (Predicted MW: 40.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ANXA2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol