Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183366 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Annexin A2 (ANXA2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTK
GDYQK ALLYLCGGDD- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Analysis of gene expressions of T cells from children with acute exacerbations of asthma.
Impaired interferon-gamma production in a subset population of severe atopic dermatitis.
Katsunuma T, Kawahara H, Suda T, Ishii T, Ohya Y, Akasawa A, Saito H, Oshida T, Sugita Y
International archives of allergy and immunology 2004 May;134(1):29-33
International archives of allergy and immunology 2004 May;134(1):29-33
Impaired interferon-gamma production in a subset population of severe atopic dermatitis.
Katsunuma T, Kawahara H, Yuki K, Akasawa A, Saito H
International archives of allergy and immunology 2004 Jul;134(3):240-7
International archives of allergy and immunology 2004 Jul;134(3):240-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
