Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183363 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Annexin A7 (ANXA7) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYP
SGFPP MGGGAYPQVP- Vial size
- 0.1 mg
Submitted references The penta-EF-hand domain of ALG-2 interacts with amino-terminal domains of both annexin VII and annexin XI in a Ca2+-dependent manner.
Reactions of partially oxidised hemoglobin solutions. I. Separation of intermediate compounds by CM-Sephadex chromatography.
Satoh H, Nakano Y, Shibata H, Maki M
Biochimica et biophysica acta 2002 Nov 4;1600(1-2):61-7
Biochimica et biophysica acta 2002 Nov 4;1600(1-2):61-7
Reactions of partially oxidised hemoglobin solutions. I. Separation of intermediate compounds by CM-Sephadex chromatography.
Ford WH, Ainsworth S
Biochimica et biophysica acta 1968 May 6;160(1):1-9
Biochimica et biophysica acta 1968 May 6;160(1):1-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting