HPA001085

SASH3 antibody from Sigma-Aldrich
753P9, CXorf9, HACS2, SH3D6C, SLY
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001085
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001085, RRID:AB_2184289
Product name
Anti-CXorf9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001085
Antibody type
Polyclonal
Antigen
SAM and SH3 domain-containing protein 3 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELR
ETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEA
EEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESG
RDDAELAGTEEQLQGLSL
Storage
-20C
Provider Type Product Number
- No reagents -