Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028814 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-BAP1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTV
LEALQQLIRVTQPELIQTHKSQESQLPEESKSASN
KSPLVLEANRA- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Nuclear up regulation of the BRCA1-associated ubiquitinase BAP1 is associated with tumor aggressiveness in prostate cancers lacking the TMPRSS2:ERG fusion
BRCA1-associated protein 1 deficiency in lung adenocarcinoma predicts poor outcome and increased tumor invasion
Steurer S, Schwemmer L, Hube-Magg C, Büscheck F, Höflmayer D, Tsourlakis M, Clauditz T, Luebke A, Simon R, Sauter G, Izbicki J, Schroeder C, Schlomm T, Huland H, Heinzer H, Haese A, Graefen M, Göbel C, Weidemann S, Lebok P, Dum D, Fraune C, Minner S, Meiners J
Oncotarget 2019;10(67):7096-7111
Oncotarget 2019;10(67):7096-7111
BRCA1-associated protein 1 deficiency in lung adenocarcinoma predicts poor outcome and increased tumor invasion
Shen C, Wang Y, Wei P, Du X
BMC Cancer 2016;16(1)
BMC Cancer 2016;16(1)
No comments: Submit comment
No validations: Submit validation data