HPA063903

antibody from Atlas Antibodies

Targeting: APBB1IP INAG1, RIAM

Antibody data

Submit

Validation data

Product number: HPA063903 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA063903, RRID:AB_2685147
Product name: Anti-APBB1IP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPS TGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETS KDKKPAL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

APBB1IP protein structure - HPA063903 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lymph node and heart muscle tissues using HPA063903 antibody. Corresponding APBB1IP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, heart muscle and lymph node using Anti-APBB1IP antibody HPA063903 (A) shows similar protein distribution across tissues to independent antibody HPA017009 (B).
Antibody #2 product nr: HPA017009
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal and non germinal center cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows no positivity in cardiomyocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity in lymphoid cells.
Sample type: HUMAN