Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504567 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cell Division Cycle 42 (GTP Binding Protein, 25kDa) (CDC42) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CDC42 antibody: synthetic peptide directed towards the N terminal of human CDC42
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSY
PQTDV FLVCFSVVSP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Transforming growth factor-beta1 (TGFbeta1) stimulates connective tissue growth factor (CCN2/CTGF) expression in human gingival fibroblasts through a RhoA-independent, Rac1/Cdc42-dependent mechanism: statins with forskolin block TGFbeta1-induced CCN2/CTGF expression.
Black SA Jr, Trackman PC
The Journal of biological chemistry 2008 Apr 18;283(16):10835-47
The Journal of biological chemistry 2008 Apr 18;283(16):10835-47
No comments: Submit comment
No validations: Submit validation data