Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007525-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007525-M02, RRID:AB_463796
- Product name
- YES1 monoclonal antibody (M02), clone 3C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant YES1.
- Antigen sequence
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAE
PTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTP
FGGASSSFSV- Isotype
- IgG
- Antibody clone number
- 3C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- YES1 monoclonal antibody (M02), clone 3C6 Western Blot analysis of YES1 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- YES1 monoclonal antibody (M02), clone 3C6. Western Blot analysis of YES1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between PTK2B and YES1. Huh7 cells were stained with anti-PTK2B rabbit purified polyclonal 1:1200 and anti-YES1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)