HPA000160

RNF113A antibody from Atlas Antibodies
Cwc24, RNF113, ZNF183
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000160
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000160, RRID:AB_611751
Product name
Anti-RNF113A
Provider product page
Atlas Antibodies - HPA000160
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKA
AYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPED
MGATAVYELDTEKERDAQAIFERSQKIQEELRGKE
DDKIYR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -