Antibody data
- Product number
- HPA000160
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000160, RRID:AB_1079821
- Product name
- Anti-RNF113A
- Provider product page
- Atlas Antibodies - HPA000160
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKA
AYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPED
MGATAVYELDTEKERDAQAIFERSQKIQEELRGKE
DDKIYR
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line MCF-7.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human gall bladder shows nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human duodenum shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells and non-germinal center cells.
- Sample type
- HUMAN