HPA000160

RNF113A antibody from Sigma-Aldrich
Cwc24, RNF113, ZNF183
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000160
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000160, RRID:AB_1079821
Product name
Anti-RNF113A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000160
Antibody type
Polyclonal
Antigen
RING finger protein 113A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKA
AYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPED
MGATAVYELDTEKERDAQAIFERSQKIQEELRGKE
DDKIYR
Storage
-20C
Provider Type Product Number
- No reagents -